PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_01498_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 171aa    MW: 19963.2 Da    PI: 8.679
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_01498_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP122.91.4e-3859134277
                                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                                 Cq+++C adl++ak+yhrrhkvCe h+k + vlv+g++qrfCqqCsrfhe+s+fD +krsCr+rLa+hn rrrk  
  Cotton_A_01498_BGI-A2_v1.0  59 CQADDCGADLKDAKQYHRRHKVCEPHAKDAFVLVKGIRQRFCQQCSRFHEISKFDGTKRSCRDRLAGHNLRRRKVM 134
                                 *************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114129.40256133IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.81E-3559136IPR004333Transcription factor, SBP-box
PfamPF031101.4E-3159132IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.5E-3159120IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MAKRACKTTV NWVDDEEEEE QREERMVKIR VVPRERYERM NTFIHYSNSA AISGGGGGCQ  60
ADDCGADLKD AKQYHRRHKV CEPHAKDAFV LVKGIRQRFC QQCSRFHEIS KFDGTKRSCR  120
DRLAGHNLRR RKVMQSDQEV ENDNNNNKNN ASYGKGTDTP MLQQWYQEFT N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3153132284squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223200.0KJ622320.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469239.11e-111PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ6Z4612e-33SPL13_ORYSJ; Squamosa promoter-binding-like protein 13
TrEMBLA0A0D2REE11e-111A0A0D2REE1_G
STRINGVIT_04s0210g00170.t014e-37(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2206745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.17e-29squamosa promoter binding protein-like 5